PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_1DEBF1E8B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 483aa    MW: 53016.3 Da    PI: 7.3914
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_1DEBF1E8B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.7e-37109168362
                 zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            + +++cprC+s++tkfCy+nny++sqPr+fC++C+ryWt+GG +rnvPvG+grr+nk++s
  Traes_3AS_1DEBF1E8B.1 109 DIIVPCPRCNSMETKFCYFNNYNVSQPRHFCRNCQRYWTAGGNIRNVPVGSGRRRNKHAS 168
                            56789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-28105165IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.267112166IPR003851Zinc finger, Dof-type
PfamPF027012.7E-31112166IPR003851Zinc finger, Dof-type
PROSITE patternPS013610114150IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MNYAQFCILS VGTIKIMVYQ FELSISCMLN NIFQVVTKLG NDANSNDVMP CVSNKLLNVE  60
ATPFCSKNRE QNDQAISKHG VEVRTGFKSE EIKTGSDGSG QDKVLKKPDI IVPCPRCNSM  120
ETKFCYFNNY NVSQPRHFCR NCQRYWTAGG NIRNVPVGSG RRRNKHASHF RHAMMSCDAN  180
IAAPGDVSNE IHHLALPLLP QVLPGPIKEN KTVKEFGSQV PVCKPMSSIH NIEEQKDTYL  240
VALASGDNSE EQSCPSPATV SGCSENQTPD SAVKKEPSNV LGYYNGITLP HPHGPALVFP  300
WSPGWNSIAV MAAAQCSTEP IQGLENVKHG LPPWAPPLMM AAPGICTPVV PFPMMPPPLW  360
SCIPGWPNGM WSSPCPGNNG PPNKITCSED NSPTLGKHSR ESDLQEENRE NNVQVPKTLR  420
IDDPSEATKS SVRDTLGIKP DEKGLFEPLQ MKVLKNDKTP ESPQALQANP AAFLRSQSFQ  480
ERT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565663.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLW5CJ330.0W5CJ33_WHEAT; Uncharacterized protein
STRINGMLOC_79421.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-53cycling DOF factor 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]